PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_20054A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 263aa    MW: 28776.8 Da    PI: 9.7568
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_20054AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.96.3e-15102146347
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                +WT++E+ +++d+ +qlG+g+W+ I++ + ++Rt+ q+ s+ qky
  Oropetium_20150105_20054A 102 PWTEDEHRKFLDGLRQLGKGDWRGISKNFVTTRTATQVASHAQKY 146
                                7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.78595151IPR017930Myb domain
SuperFamilySSF466891.0E-1796151IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-1898150IPR006447Myb domain, plants
SMARTSM007173.7E-1099149IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-11100145IPR009057Homeodomain-like
PfamPF002495.0E-12102146IPR001005SANT/Myb domain
CDDcd001677.00E-10102147No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MERXXXXXXX XXXXTAAPVM SFRLFGMDLL VVAGEFVDEE EGDGLPMEMK KSFSTPNLNS  60
LNGILQPGEV VGKGYASDDG DLASPQQKRR RRKAQERKKG IPWTEDEHRK FLDGLRQLGK  120
GDWRGISKNF VTTRTATQVA SHAQKYFLRQ TNPGKKKRRA SLFDVGIADS NNNDHVPSPQ  180
SIATKPAPAE EIIHTDRGDV PVSELTSFFK RSKGHGESSF ASMASVLETA SSISSLELTM  240
AINSLDLSIA PPRGGAEAIR VL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18792KRRRRK
28798KRRRRKAQERKK
38898RRRRKAQERKK
4154158KKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2516101e-108AK251610.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf129a20, mRNA sequence.
GenBankAK3624571e-108AK362457.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2005J10.
GenBankAK3702741e-108AK370274.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2108A12.
GenBankAK3731651e-108AK373165.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3022M03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983632.11e-104PREDICTED: protein REVEILLE 2-like
TrEMBLA0A0A9KKT01e-123A0A0A9KKT0_ARUDO; Uncharacterized protein
STRINGSi036966m1e-104(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104643043
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-33MYB_related family protein